Identifiers and Description

Gene Model Identifier

IMG5_097960

Standard Name

FDD1 (Fatty acid Desaturase Domain)

Aliases

None

Description

Fatty acid desaturase-related protein

Genome Browser

GBrowse

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>IMG5_097960(coding)
ATGACAACCCTTGAAATAATAGACAATATAACCCTCTTTAGTTCTTTTCAATATTATATG
ATCCCGCTACTTTACCCGTTTGCCTTCATAGCTTTTAAATACTTAAAGCAATATTTTTTC
TTTATTCTAATAGTATATACCGTAATTCCTTACTGCGATCATTTCTTTCCTTTAGACCTA
AAAAACCCTACAAAAGAAGAAATAAAAAAGCTTACTGGAAAAATCAAATACAGAATTCCT
TTATACCTATCCGTTGTTCTAGATTGGCTATTTACATTTTGGTGTATAGACTATATTTGT
ATAAATAGAGAAAAACTCTCCTATTTACAATAATTTGGAATAATTTTTTCCGTATCCAAC
GCCGGCACATCTAACATAAACGTTGCCCATGAACTGTTTCACAAAGACCGCATACAAGAC
AAGATCTTAGGCTATTTAACACTTGCGAAAAACCTTTATATGCATTTCGCAATCGAGCAT
ATATAAGGACATCACAAAAACGTCGCGACACATAAAGACGCAGCTACATCAAGATTAAAC
TAAAGTCTATATGAGTTTTTACCTTAGACATTAATAGGAACTTATAAGAATGCTTGGAAT
ATCGAAAATGAATAATAGATTTTTAAAATATATGGATACTATGGTGGAATGCTATTCTTA
TTCTAGAGTTTTGTTTCTGTAGTCTATTTAGAAATGGCTAATTATGTAGAACATTACGGA
CTTGTGAGAAAGGAAATTTCTCCAGGAGTATATGAGCCAGTAAATATAAAATTCTCTTGG
AATGCACCACATAGGGTTTCAAATTATTTACTTTTTAAAATATAAAGACATTCTGATCAT
CATGAAAATAGTTATAAGGAATATTAAACGTTATGTAGTTATGATGAAAGTCCTTAATTA
CCTCATGGATATACTGTTTGTGTACTTATGGCATTGTTCCCAAAGATATGGTTCAAGATT
ATGAATAAATAACTTAAAAATTATTAAAAAGAAGGCAAAAATATTATTGATAAAGAAATT
TAAGATGAAGTTTGGAAGTTTATTTAAAAACTTACTATAGGGCTTTTTGTTTTATCAATT
ATAAGTGTTTATTTATGA


>IMG5_097960(protein)
MTTLEIIDNITLFSSFQYYMIPLLYPFAFIAFKYLKQYFFFILIVYTVIPYCDHFFPLDL
KNPTKEEIKKLTGKIKYRIPLYLSVVLDWLFTFWCIDYICINREKLSYLQQFGIIFSVSN
AGTSNINVAHELFHKDRIQDKILGYLTLAKNLYMHFAIEHIQGHHKNVATHKDAATSRLN
QSLYEFLPQTLIGTYKNAWNIENEQQIFKIYGYYGGMLFLFQSFVSVVYLEMANYVEHYG
LVRKEISPGVYEPVNIKFSWNAPHRVSNYLLFKIQRHSDHHENSYKEYQTLCSYDESPQL
PHGYTVCVLMALFPKIWFKIMNKQLKNYQKEGKNIIDKEIQDEVWKFIQKLTIGLFVLSI
ISVYL


>IMG5_097960(gene)
ATGACAACCCTTGAAATAATAGACAATATAACCCTCTTTAGTTCTTTTCAATATTATATG
ATCCCGCTACTTTACCCGTTTGCCTTCATAGCTTTTAAATACTTAAAGCAATATTTTTTC
TTTATTCTAATAGTATATACCGTAATTCCTTACTGCGATCATTTCTTTCCTTTAGACCTA
AAAAACCCTACAAAAGAAGAAATAAAAAAGCTTACTGGAAAAATCAAATACAGAATTCCT
TTATACCTATCCGTTGTTCTAGATTGGCTATTTACATTTTGGTGTATAGACTATATTTGT
ATAAATAGAGAAAAACTCTCCTATTTACAATAATTTGGAATAATTTTTTCCGTATCCAAC
GCCGGCACATCTAACATAAACGTTGCCCATGAACTGTTTCACAAAGACCGCATACAAGAC
AAGATCTTAGGCTATTTAACACTTGCGAAAAACCTTTATATGCATTTCGCAATCGAGCAT
ATATAAGGACATCACAAAAACGTCGCGACACATAAAGACGCAGCTACATCAAGATTAAAC
TAAAGTCTATATGAGTTTTTACCTTAGACATTAATAGGAACTTATAAGAATGCTTGGAAT
ATCGAAAATGAATAATAGAGTAAAAATAATAGATATACTTTTAATATTATATATAACAGA
ATGTATTTTTTTACTTTCATGATGTTCTTTTTGCCTTATATAGTTTTTAAAATATATGGA
TACTATGGTGGAATGCTATTCTTATTCTAGAGTTTTGTTTCTGTAGTCTATTTAGAAATG
GCTAATTATGTAGAACATTACGGACTTGTGAGAAAGGAAATTTCTCCAGGAGTATATGAG
CCAGTAAATATAAAATTCTCTTGGAATGCACCACATAGGGTTTCAAATTATTTACTTTTT
AAAATATAAAGACATTCTGATCATCATGAAAATAGTTATAAGGAATATTAAACGTTATGT
AGTTATGATGAAAGTCCTTAATTACCTCATGGATATACTGTTTGTGTACTTATGGCATTG
TTCCCAAAGATATGGTTCAAGATTATGAATAAATAACTTAAAAATTATTAAAAAGAAGGC
AAAAATATTATTGATAAAGAAATTTAAGATGAAGTTTGGAAGTTTATTTAAAAACTTACT
ATAGGGCTTTTTGTTTTATCAATTATAAGTGTTTATTTATGA